PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_012568850.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family LBD
Protein Properties Length: 168aa    MW: 18646.8 Da    PI: 5.2311
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_012568850.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260142.31.5e-4412110199
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrrkC +dC++apyfp e+p+kfanvhk+FGasnv+kll+++++++reda++sl+yeAear++dPvyG+vg i+ lq+q+ +l++el+
  XP_012568850.1  12 PCAACKFLRRKCMPDCIFAPYFPPEEPQKFANVHKIFGASNVSKLLNEVQPNQREDAVNSLAYEAEARIKDPVYGCVGAISVLQRQVIRLQKELD 106
                     7*********************************************************************************************9 PP

          DUF260  96 llke 99 
                     ++++
  XP_012568850.1 107 ATNA 110
                     9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.86211112IPR004883Lateral organ boundaries, LOB
PfamPF031952.9E-4412109IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MIMSSSSYTN SPCAACKFLR RKCMPDCIFA PYFPPEEPQK FANVHKIFGA SNVSKLLNEV  60
QPNQREDAVN SLAYEAEARI KDPVYGCVGA ISVLQRQVIR LQKELDATNA DLIRYTCTDI  120
TNQDSRRIGE EGGSSLGQSP HEGFYYPSTP WNNDPLGDGY HTGGDNTM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012568850.11e-126PREDICTED: LOB domain-containing protein 25-like isoform X1
SwissprotQ8L8Q37e-69LBD25_ARATH; LOB domain-containing protein 25
TrEMBLV7B4I61e-106V7B4I6_PHAVU; Uncharacterized protein
STRINGGLYMA19G12650.33e-93(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF109134112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.14e-70LOB domain-containing protein 25